PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0498s0004.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 558aa    MW: 62114.1 Da    PI: 5.4804
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0498s0004.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like75.95.4e-24132185155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+++ W++eLH++F++ ++ + G ++A+Pk+ile+m+v+gLt+e+++SHLQkYR+
  Kalax.0498s0004.1.p 132 KQKVAWSTELHNKFLDSLKII-GLDRAVPKKILEVMNVPGLTRENIASHLQKYRI 185
                          799******************.********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011013.664139IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23001.8E-7164No hitNo description
SuperFamilySSF521725.14E-6154IPR011006CheY-like superfamily
PROSITE profilePS5129410.119129188IPR017930Myb domain
SuperFamilySSF466891.06E-17130189IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-23131189IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-22132185IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MSADDKEQTM VKGLECGAVY FMRKPVRQDD LKNVWQYAIP KRRHEASSQI VIEDSRVLGS  60
NSSSSEQDQA GAANSVRIPT HGHTPSNADT TSRSVPDKYY EEVVPKRKLT NSKRKVKSSN  120
SGQGHSNNLV KKQKVAWSTE LHNKFLDSLK IIGLDRAVPK KILEVMNVPG LTRENIASHL  180
QKYRIFLKRV ADVTETPDGM GLSMGNRVYR SNLSYSQLYY GFQLEHLEIT DENLLRKMLK  240
QELRAIRDPL YRGPSSRYQG PPTLSGTMRT PFKSIYSSFA FEPRDYLNKQ MPIIFGERLM  300
GADSYRLTSL GSNEIMQQAA APAPAPAPAQ SSELVQFGMY TTGSRLHTSG LVNDIEAQGG  360
TIDMGTSYDM ETENGQMMPQ VTYCNAAMRQ LENGPTQQVL LQPDVHDSIS DLSTSNLDIS  420
GFQGDFSGFL VNQLNGGDDT FNYLEEAGND VVGYPYIGYG SNYSAHDNQD KNQESAPILN  480
QQFGDGLSLI QTSHGDYPYF DDDFFPWSDH EPFQSQPGDQ NANMLMVDER DASGCHEEVA  540
GPLVNGSSKW SNHLRTE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-20131191464ARR10-B
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.19e-34response regulator 1